Microbulbifer sp. A4B17: BTJ40_06425 Help Entry BTJ40_06425       CDS       T05421                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism mii  Microbulbifer sp. A4B17 Brite KEGG Orthology (KO) [BR:mii00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mii03036]     BTJ40_06425 Chromosome and associated proteins [BR:mii03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BTJ40_06425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC CENP-H Motif Other DBs NCBI-ProteinID:  AWF80478 UniProt:  A0A2S1JQ10 LinkDB All DBs Position 1452054..1452344 Genome browser AA seq 96 aa AA seqDB search MKWLLAILTIMLLATQYRLWVGEGSLAEVTRLKRQLAQQQEKNIALVRENRQLFREVRSL KIGTDGVEAKARYDLGLIKEGETLFIFLDKKEEAEN NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaatggctgctggcaatactcaccattatgctcctcgccacccagtaccgactttgg gttggtgaaggtagtctcgccgaagttacacgtctcaagcgtcaattagcccaacagcaa gaaaaaaatatcgcgctggtgcgggaaaaccgtcaactgttcagggaagtccgcagtttg aaaattggcacagatggtgtggaagcgaaagcccgttatgacctgggactgatcaaggaa ggggaaacactgtttatcttcctggataagaaggaagaggctgaaaattga

DBGET integrated database retrieval system