Microbulbifer sp. A4B17: BTJ40_08360
Help
Entry
BTJ40_08360 CDS
T05421
Name
(GenBank) hypothetical protein
KO
K06918
uncharacterized protein
Organism
mii
Microbulbifer sp. A4B17
Brite
KEGG Orthology (KO) [BR:
mii00001
]
09190 Not Included in Pathway or Brite
09194 Poorly characterized
99997 Function unknown
BTJ40_08360
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DUF463
DO-GTPase2
KAP_NTPase
AAA_25
MeaB
ABC_tran
AAA_22
MMR_HSR1
AAA_29
nSTAND3
Pox_A32
PRK
TrwB_AAD_bind
AAA_18
RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID:
AWF80813
LinkDB
All DBs
Position
1837464..1838933
Genome browser
AA seq
489 aa
AA seq
DB search
MEPKLTECVSMEHEDSVHTESQSRPRLKEKLRRWGREAQDKSHWATERLLDRRICIGITG
LSGAGKSTFLTSLIYQLSNPEKSQLPGFAPALNGDLLGAELKPALDSGLNPFDYETCLSA
LMAELPSWPQSTREASAMELHIHLRSRRRFRKAGRKTLVVELRDYPGEWLMDLPLLRMDY
AEWCRHQTHLLSTDARSKLAPELAAQLAALSPQASADEVDLDELWVGYRRFLLNCRARFN
LSYLQPGRALLDEEAYGVVPLLDLRGLDPAQLAALPESSVFKILQARYDRYVKNQVRPFV
DSHFRHLDRQLVLVDMIGALFAGEQSLEDMRLAFTHLADTFRYGESGVISKLWRPKVNRL
LFAATKVDQVLAADHDALRQLLGQQLQQAFSDARHRGLPVFSEAIAAVRCSREGQRNGRR
MLMGYDLQGQYLGFENAEIFSQLPYEDQGWSHYAGAAPPQLRPPVGMQAGHIPHIRVDAL
LNLLLGDKV
NT seq
1470 nt
NT seq
+upstream
nt +downstream
nt
atggaacccaaattgacagagtgtgtgtcgatggaacacgaggactctgtgcatactgag
agtcaatcccgtccacgtttaaaagaaaagttgcgccgttggggccgagaggcccaggat
aaatctcattgggcaacagagcgtctattggaccgacgcatctgcatcggtatcactggg
ctcagtggcgccggcaaatccacgtttcttaccagtctgatttaccaactcagcaaccca
gaaaaatcccagttacccggttttgctccagcactcaatggcgatttgctgggcgctgag
ctgaaaccggcactggattctggcctgaacccgtttgactatgaaacctgcctgtcggcg
cttatggctgagctgcccagctggcctcaaagtacccgagaagcttcggcgatggagttg
cacatccatttgcgcagtcggcgtcgcttccgaaaggccggaagaaagacgttggtagta
gagttacgtgactaccctggcgagtggttgatggacctgccactgctgcgtatggactat
gcggaatggtgtcgtcatcaaacacatttactctccactgatgcgcgctcaaagcttgct
cctgagttggcagctcagctggcggcattgtcaccgcaggcgagtgcagatgaagttgat
ctggatgaattatgggtgggataccgtcgatttctcctgaattgtcgagccaggttcaac
ctcagttacttgcaacctggcagagcgcttttggatgaagaggcatatggagtagtgcca
cttctcgatttgcgtggactagatcctgcacagttagccgcattgccggagagtagcgtt
tttaagatcttgcaggcgcggtacgatcgctacgtaaaaaatcaggtgaggcctttcgtc
gacagccattttcggcacctcgatcgacagctggtactggttgatatgattggcgcccta
tttgctggtgagcagtccctggaagatatgcgcctggcattcactcatcttgccgatact
tttcgctatggtgagtcaggagttatcagcaaactttggcgccccaaagttaatcgactc
ctctttgctgccacaaaagtggatcaggtgcttgccgccgatcacgatgccctgagacaa
cttcttggacaacaattgcaacaggctttctccgacgcccgccaccgaggtttaccggtg
tttagcgaggcgatcgcggcggtgcgctgctccagagaggggcagaggaatggaaggagg
atgctgatggggtacgatttgcagggtcaatatttaggctttgaaaatgcggagatcttt
tcccagctcccctatgaggaccagggctggagccactatgccggtgccgcaccgccacag
ttaaggccgccagtgggaatgcaggcaggacatattccgcacattcgagtggatgccctt
ttgaatcttctgctgggagataaggtttga
DBGET
integrated database retrieval system