Microbulbifer sp. A4B17: BTJ40_13350 Help Entry BTJ40_13350       CDS       T05421                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mii  Microbulbifer sp. A4B17 Pathway mii01100   Metabolic pathways mii01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mii00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BTJ40_13350    00074 Mycolic acid biosynthesis     BTJ40_13350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BTJ40_13350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AWF81733 LinkDB All DBs Position complement(3004347..3004583) Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQLAMDYIKDNLG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagagcgcgtaaaaaagatcgttgctgaacaactgggcgttaaggaa gaagatgttaaacctgaagcctcttttgttgaagatctgggcgctgactcactcgacaca gttgagctggtaatggctttggaagaggaattcgagactgaaattcccgatgaagaagct gaaaaaatcactactgttcagctggcaatggattacatcaaggacaaccttggttaa

DBGET integrated database retrieval system