Microbulbifer sp. A4B17: BTJ40_16940 Help Entry BTJ40_16940       CDS       T05421                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism mii  Microbulbifer sp. A4B17 Brite KEGG Orthology (KO) [BR:mii00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mii03036]     BTJ40_16940 (ftsL) Chromosome and associated proteins [BR:mii03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BTJ40_16940 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Cpta_toxin Motif Other DBs NCBI-ProteinID:  AWF83498 UniProt:  A0A2S1JYT1 LinkDB All DBs Position complement(3856664..3856939) Genome browser AA seq 91 aa AA seqDB search MSGKALLGMGVMWVAVILSSLSVIQSTQQSRELTAELGKAQKAHDELRYEQERLLLEKSA WSAYSRVEQVAQEKLKMHMPAPSEQVLVVVD NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtccggcaaggctctgcttggaatgggagtgatgtgggtagcggtaatcctatcgtcg ctttcggttattcaaagtacccagcaaagtcgggagttgaccgctgagttgggtaaggcg caaaaagcccacgatgagttgcgctacgagcaggagcgtctccttttggaaaaaagtgcc tggtctgcctatagccgggtcgaacaggtcgcacaagaaaaattaaaaatgcacatgcct gcgccttcggaacaggtactggtggtagtggattaa

DBGET integrated database retrieval system