Microlunatus elymi: FOE78_07010
Help
Entry
FOE78_07010 CDS
T06101
Name
(GenBank) ATP-grasp domain-containing protein
KO
K11263
acetyl-CoA/propionyl-CoA/long-chain acyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:
6.4.1.2
6.4.1.3
6.4.1.-
6.3.4.14
]
Organism
mik
Microlunatus elymi
Pathway
mik00061
Fatty acid biosynthesis
mik00074
Mycolic acid biosynthesis
mik00280
Valine, leucine and isoleucine degradation
mik00620
Pyruvate metabolism
mik00630
Glyoxylate and dicarboxylate metabolism
mik00640
Propanoate metabolism
mik01100
Metabolic pathways
mik01110
Biosynthesis of secondary metabolites
mik01120
Microbial metabolism in diverse environments
mik01200
Carbon metabolism
mik01212
Fatty acid metabolism
Module
mik_M00082
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:
mik00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
FOE78_07010
00630 Glyoxylate and dicarboxylate metabolism
FOE78_07010
00640 Propanoate metabolism
FOE78_07010
09103 Lipid metabolism
00061 Fatty acid biosynthesis
FOE78_07010
00074 Mycolic acid biosynthesis
FOE78_07010
09105 Amino acid metabolism
00280 Valine, leucine and isoleucine degradation
FOE78_07010
Enzymes [BR:
mik01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
FOE78_07010
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
FOE78_07010
6.4.1.3 propionyl-CoA carboxylase
FOE78_07010
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Biotin_lipoyl
ATP-grasp
Biotin_lipoyl_2
Dala_Dala_lig_C
LAL_C2
ATP-grasp_5
ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID:
QDP98641
UniProt:
A0A516Q628
LinkDB
All DBs
Position
complement(1567641..1569392)
Genome browser
AA seq
583 aa
AA seq
DB search
MSKVLVANRGEIAVRVIRAAADAGLGSVAVYAEPDTDSLFVQLADEAYALGGSTPADTYL
DITKIIDAARRSGADAVHPGYGFLAENSAFAQAVIDAGLTWIGPPPAAIDALGDKVQARH
IAQKVGAPLVPGTADPVADADEIVAFAQEHGLPVAIKAAFGGGGRGLKVARTMEEIPDLF
DSAVREAVTAFGRGECFVERFLDHPRHVETQCLADEHGNVVVVSSRDCSLQRRNQKLVEE
APAPFLTDDQLATLYSASKAILSEAGYVGAGTCEFLVGVDGTISFLEVNTRLQVEHPVSE
EVTGMDLVREMFRIADGAELTGGDPQIRRHSIEFRINAEDAGRNFMPAPGTLTRWQPPSG
PGVRVDEGYRAGMTVPGSFDSLVAKIIVTGSDRTEAIARSRRALAELEIEGMPTVLPFHR
AVVEDPAFVAADGTFAVHTRWIETEFDNRIPPYAGPVGEAPEAAEKTTVVVEVNGKRLEV
ALPAELGAMSAPGNTATKKPKRQRRAGGAAAASGNALTSPMQGTIVKIVVADGDEVAEGD
LIVVLEAMKMEQPLSAHRAGKITGLSAAVGETVTSGSVICEIV
NT seq
1752 nt
NT seq
+upstream
nt +downstream
nt
atcagcaaggttctggtcgcgaaccggggcgagatcgcagtccgagtgatccgcgccgcc
gccgatgccggactcggcagtgtcgccgtctacgccgagcccgataccgactcgctgttc
gtgcaactcgccgacgaggcgtacgcgctgggcggcagcacgccggccgacacctatctg
gacatcaccaagatcatcgacgccgctcggcgcagcggcgccgacgcggtccatcccggc
tacggcttcctggccgagaactccgccttcgcccaggccgtgatcgacgccggactgacc
tggatcggcccgccgccggcagccatcgacgccctcggggacaaggtgcaggcccggcac
atcgcccagaaggtcggcgccccgttggtgcccggcaccgccgacccggtcgccgacgcg
gacgagatcgttgcgttcgcgcaggagcacggtttgccggtggcgatcaaggcggccttc
ggcggcggcggccgcggcctcaaggtggcccggacgatggaggagatcccggatctgttc
gactccgcggtccgcgaggcggtcactgccttcggccgcggcgagtgcttcgtcgagcgt
ttccttgatcatccccggcacgtggagacccagtgcctggccgacgagcacggcaacgtg
gtggtggtgtccagccgggactgctcgctgcagcgacgcaaccagaaactggtcgaggag
gcgccggcgccgttcctcaccgatgatcaactggccaccctctactcggcgtcgaaggcg
atcctgtccgaggccggctacgtcggcgccggcacctgcgaattcctggtcggcgtcgac
ggcaccatctccttcctcgaggtcaacacccgactgcaggtggagcatccggtctcggag
gaggtcaccggcatggacctggtccgggagatgttccggatcgccgacggcgcggagctg
accggcggcgatccgcagatccgccggcactcgatcgagttccggatcaacgccgaggac
gcgggccgcaacttcatgccggcgccgggcacgctgacccgctggcagccgccgtccggt
ccgggagtccgggtggacgagggctatcgcgccggcatgacggtgccgggcagtttcgac
tcgctggtggccaagatcatcgtcaccggttccgaccgcaccgaggcgatcgctcgcagc
cggcgagccctggcggagttggagatcgagggcatgccgacggtgctgccgttccaccgc
gcggtggtggaggatccggccttcgtcgcggccgacggcaccttcgccgtgcacacgcgc
tggatcgagaccgagttcgacaaccggatcccgccgtacgcgggtccggtcggcgaggcg
cccgaggcggcggagaaaaccaccgtggtggtcgaggtgaacgggaagcggttggaggtc
gcactgcccgccgagttgggcgcgatgagtgctcccggcaacaccgccaccaagaagccg
aagcggcagcgtagggcgggcggggcggcagcggcctcgggcaacgcgctgacctcaccg
atgcagggcaccatcgtcaagatcgtcgtcgccgacggcgacgaggtggccgagggcgac
ctgatcgtcgtcctggaggcgatgaagatggagcagccgctgtcggcccatcgcgccggc
aagatcaccggactgtccgcggcggtcggcgagaccgtgaccagcggttcggtgatctgc
gagatcgtctga
DBGET
integrated database retrieval system