Microlunatus elymi: FOE78_11550 Help Entry FOE78_11550       CDS       T06101                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mik  Microlunatus elymi Brite KEGG Orthology (KO) [BR:mik00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     FOE78_11550 Enzymes [BR:mik01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      FOE78_11550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like DUF3088 GST_N_2 Thioredoxin GST_N_3 CIMIP3 Motif Other DBs NCBI-ProteinID:  QDP96455 UniProt:  A0A516PZ54 LinkDB All DBs Position complement(2562052..2562294) Genome browser AA seq 80 aa AA seqDB search MSTFTMYTTPWCGYCFRLKQQLKREQIDFDEVDIEQQPAAAELVASVNHGNQTVPTLVFS DGSALTNPSVREVTAKLASL NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcacgttcaccatgtacaccaccccctggtgcggatattgcttccggctgaagcag caactgaagcgcgagcagatcgacttcgacgaggtggacatcgagcaacagccggcggcc gctgagctggtggcgtcggtgaatcacggcaatcagaccgtgccgacgctggtgttctcc gacggttccgcgctgacgaacccgtcggtgcgcgaggtgaccgccaagctcgcgtcgctc tga

DBGET integrated database retrieval system