KEGG   Micromonospora sp. L5: ML5_4421
Entry
ML5_4421          CDS       T01379                                 

Name
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K15944  nogalaviketone/aklaviketone reductase [EC:1.1.1.- 1.1.1.362]
Organism
mil  Micromonospora sp. L5
Pathway
mil01057  Biosynthesis of type II polyketide products
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
Module
mil_M00781  Nogalavinone/aklavinone biosynthesis, deoxynogalonate/deoxyaklanonate => nogalavinone/aklavinone
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    ML5_4421
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:mil01008]
    ML5_4421
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.362  aklaviketone reductase
     ML5_4421
    1.1.1.-  
     ML5_4421
Polyketide biosynthesis proteins [BR:mil01008]
 Polyketide tailoring proteins
  Others
   ML5_4421
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Sacchrp_dh_NADP RmlD_sub_bind LDcluster4 Polysacc_synt_2
Other DBs
NCBI-ProteinID: ADU09898
LinkDB
Position
complement(4698911..4699678)
AA seq 255 aa
MGNGNRSAPRRSIVITGGGTGIGRAVARGFAEQGDDVLIVGRTAASLRDTAEGYPGIRTS
VADITAPGAPQAVVDAAQQAYGRIDVLVNNAATSVAKLLADTTEEEIQSQFATNVMAPIH
LTRCALEPLAASRGVVVNISTAGALGQRTWPANGAYGASKVALDFLTRTWAVEMAPRGIR
VVGIAPGVADTGIGVRSGMTEEQYADFLKWMADRAPAGRVGTPEEIATWVRKLVEPDAGY
LTGVVIPIDGGLSLT
NT seq 768 nt   +upstreamnt  +downstreamnt
atgggtaatgggaacaggtccgcgccgaggcgcagcatcgtcatcaccggcggcggcacc
ggcatcggccgcgccgtggcccgcgggttcgccgagcagggcgacgacgtcctgatcgtc
ggccgtactgcggcgagcctgagggacaccgccgagggttacccgggcatccggacgtct
gtcgccgacatcaccgctcccggcgcaccgcaggccgtcgtcgacgcggctcagcaggcg
tacgggcggatcgacgtcctggtcaataacgccgccacgtcggtcgcgaagctcctcgcc
gacaccacggaggaggagatccagtcgcagttcgcgacgaatgtcatggcaccgatccac
ctgacgcggtgtgctctcgaacccctcgcggccagccggggcgtggtggtcaacatcagc
acggcgggcgcgctcggccagcggacgtggcccgccaacggggcgtacggcgcgagtaag
gtggcgctggactttctgacccgcacctgggccgtcgagatggctccgcgcgggatccgg
gtcgtggggatcgcgcccggcgtcgccgatacgggtatcggggtccgcagcggcatgacc
gaggagcagtacgccgacttcctcaagtggatggccgaccgtgcgccggcgggacgggtc
ggcacgccggaggagatcgccacttgggtgcgcaagctcgtcgagccggacgccggttac
ctgaccggcgtagtgatcccgatcgacggaggcctgtccctcacctga

DBGET integrated database retrieval system