KEGG   Mangifera indica (mango): 123202575
Entry
123202575         CDS       T07684                                 
Name
(RefSeq) SKP1-like protein 1B
  KO
K03094  S-phase kinase-associated protein 1
Organism
minc  Mangifera indica (mango)
Pathway
minc03083  Polycomb repressive complex
minc04120  Ubiquitin mediated proteolysis
minc04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:minc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    123202575
   04120 Ubiquitin mediated proteolysis
    123202575
  09126 Chromosome
   03083 Polycomb repressive complex
    123202575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:minc04131]
    123202575
   04121 Ubiquitin system [BR:minc04121]
    123202575
   03036 Chromosome and associated proteins [BR:minc03036]
    123202575
Membrane trafficking [BR:minc04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    123202575
Ubiquitin system [BR:minc04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     123202575
   Cul7 complex
     123202575
Chromosome and associated proteins [BR:minc03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     123202575
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     123202575
SSDB
Motif
Pfam: Skp1_POZ Skp1 BTB Methyltransf_16
Other DBs
NCBI-GeneID: 123202575
NCBI-ProteinID: XP_044474448
LinkDB
Position
19:complement(12816251..12818022)
AA seq 155 aa
MSNSKKITLKSADGEAFEVDEVVALESQTIKHMIEDDCADNGIPLPNVTSQILSKVIEYC
KKHVEATKSDDRSVDEDLKAWDAEFIKVDQATLFDLILAANYLNIKSLLDLTCQTVADMM
KGKTPEDIRKTFQIANDFTPEEEEEVRRENLWAFE
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtcaaatagcaagaaaatcactctgaaaagcgccgatggggaggcgttcgaggttgat
gaagtggtggctttggaatcgcagacgataaagcatatgatcgaggacgattgcgccgac
aatggaattcctctccctaatgtgaccagccagatcctttcgaaggttatcgagtactgc
aagaagcacgtcgaggccaccaagtccgacgatcgttctgttgatgaagatctcaaggcc
tgggatgccgagttcatcaaagttgatcaggccactctctttgatctcatcctcgctgca
aactatctcaacatcaaaagcttgttggacctgacttgccagacagttgcagatatgatg
aagggcaaaacaccagaggatattcgcaaaacatttcaaattgcaaatgactttacacca
gaagaggaggaggaggttcgtcgggagaatctttgggcttttgagtga

DBGET integrated database retrieval system