Mangifera indica (mango): 123207085 Help Entry 123207085         CDS       T07684                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism minc  Mangifera indica (mango) Pathway minc03083   Polycomb repressive complex minc04120   Ubiquitin mediated proteolysis minc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:minc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123207085    04120 Ubiquitin mediated proteolysis     123207085   09126 Chromosome    03083 Polycomb repressive complex     123207085  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:minc04131]     123207085    04121 Ubiquitin system [BR:minc04121]     123207085    03036 Chromosome and associated proteins [BR:minc03036]     123207085 Membrane trafficking [BR:minc04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     123207085 Ubiquitin system [BR:minc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      123207085    Cul7 complex      123207085 Chromosome and associated proteins [BR:minc03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      123207085   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      123207085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB Methyltransf_16 Motif Other DBs NCBI-GeneID:  123207085 NCBI-ProteinID:  XP_044480276 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSNSKKITLKSADGEAFEVDEVVALESQTIKHMIEDDCADNGIPLPNVTSQILSKVIEYC KKHVEATKSDDRSVDEDLKAWDAEFIKVDQATLFDLILAANYLNIKSLLDLTCQTVADMM KGKTPEDIRKTFQIANDFTPEEEEEVRRENLWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcaaatagcaagaaaatcactctgaaaagcgccgatggggaggcgttcgaggttgat gaagtggtggctttggaatcgcagacgataaagcatatgatcgaggacgattgcgccgac aatggaattcctctccctaatgtgaccagccagatcctttcgaaggttatcgagtactgc aagaagcacgtcgaggccaccaagtccgacgatcgttctgttgatgaagatctcaaggcc tgggatgccgagttcatcaaagttgatcaggccactctctttgatctcatcctcgctgca aactatctcaacatcaaaagcttgttggacctgacttgccagacagttgcagatatgatg aagggcaaaacaccagaggatattcgcaaaacatttcaaattgcaaatgactttacacca gaagaggaggaggaggttcgtcgggagaatctttgggcttttgagtga

DBGET integrated database retrieval system