Mangifera indica (mango): 123214573 Help Entry 123214573         CDS       T07684                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism minc  Mangifera indica (mango) Pathway minc04145   Phagosome minc04148   Efferocytosis minc04517   IgSF CAM signaling minc04518   Integrin signaling minc04620   Toll-like receptor signaling pathway minc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:minc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123214573    04518 Integrin signaling     123214573  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123214573    04148 Efferocytosis     123214573  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123214573  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123214573  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:minc04131]     123214573   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:minc04147]     123214573    04031 GTP-binding proteins [BR:minc04031]     123214573 Membrane trafficking [BR:minc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123214573  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123214573   Macropinocytosis    Ras GTPases     123214573  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123214573 Exosome [BR:minc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123214573   Exosomal proteins of other body fluids (saliva and urine)    123214573   Exosomal proteins of colorectal cancer cells    123214573   Exosomal proteins of bladder cancer cells    123214573 GTP-binding proteins [BR:minc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123214573 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  123214573 NCBI-ProteinID:  XP_044490365 LinkDB All DBs Position 4:12998360..13001469 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPVILVGTKL DLREDNQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAHKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtcgaggttcataaagtgcgtgacagtcggtgacggcgccgttggcaagact tgcatgcttatttcctacaccagcaacacttttccgacggactatgtgccaactgtcttt gacaattttagtgcaaatgtggttgtggatggaagcactgttaatctagggttatgggat accgcaggccaggaagattacaatagattaagacctttgagctatcgcggggcagatgtg ttcctgcttgcattttctctcattagcaaggccagctatgaaaatgttgccaagaaatgg attcctgaattgaggcactatgcacctggtgttccagttattcttgttgggacaaagctt gatcttcgggaagataatcaattctttatagatcaccctggtgcagtgcccattaccaca gcccagggagaggaattgagaaagctgattggagctcctgtttacatcgagtgtagttca aaaacacaacagaatgtgaaagctgtctttgatgcggccatcaaggtggttctccagccg ccaaagcagaagaagaaaaagaagagaaaggcacataaggcctgctctatattgtga

DBGET integrated database retrieval system