Mangifera indica (mango): 123228095 Help Entry 123228095         CDS       T07684                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism minc  Mangifera indica (mango) Brite KEGG Orthology (KO) [BR:minc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:minc03041]     123228095   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:minc04052]     123228095 Spliceosome [BR:minc03041]  Complex B   Other components    Complex B specific factors     123228095 Cytokines and neuropeptides [BR:minc04052]  Neuropeptides   Unclassified    123228095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  123228095 NCBI-ProteinID:  XP_044509246 LinkDB All DBs Position 10:complement(3604186..3607082) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLKDY EIHDGMGLELYYS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtgttgaacgatcggctagggaagaaggtgcgcgtgaagtgcaacgat gatgacaccatcggtgacttgaagaagctggtggctgctcaaaccggtactcgagcggac aagattcggattcagaagtggtataccatctataaggatcatatcactcttaaggactac gagatccatgatggcatgggcctcgagctctactacagctaa

DBGET integrated database retrieval system