Methylobacterium indicum: mvi_16650 Help Entry mvi_16650         CDS       T07581                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mind  Methylobacterium indicum Pathway mind00190   Oxidative phosphorylation mind01100   Metabolic pathways Module mind_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mind00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     mvi_16650  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mind00194]     mvi_16650 Photosynthesis proteins [BR:mind00194]  Photosystem and electron transport system   F-type ATPase [OT]    mvi_16650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  BCM83204 UniProt:  A0A0J6RH21 LinkDB All DBs Position 1818639..1818866 Genome browser AA seq 75 aa AA seqDB search MDPVAAKYIGAGLACLGMAGAAMGLGNLFGQFFAGALRNPSAADGQRANLLLGFALTEAL GIFSLLVALLLLFAV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatcccgttgctgcgaagtacatcggcgccggcctcgcctgcctcggcatggcgggc gccgccatgggcctcggcaacctgttcggccagttcttcgccggcgccctgcgcaacccc tccgcggccgacggccagcgcgccaacctgctcctcggcttcgcgctgaccgaggcgctg ggcatcttctcgctgctcgtcgcgctgctgctgctgttcgccgtctga

DBGET integrated database retrieval system