Methylobacterium indicum: mvi_48420 Help Entry mvi_48420         CDS       T07581                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism mind  Methylobacterium indicum Pathway mind03430   Mismatch repair Brite KEGG Orthology (KO) [BR:mind00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     mvi_48420  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mind03400]     mvi_48420 Enzymes [BR:mind01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      mvi_48420 DNA repair and recombination proteins [BR:mind03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      mvi_48420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S RL10P_insert Motif Other DBs NCBI-ProteinID:  BCM86381 UniProt:  A0A0J6QLF2 LinkDB All DBs Position complement(5247395..5247685) Genome browser AA seq 96 aa AA seqDB search MSAARSDASRAAASAPAGPTGTADLPFEKALEELEGIVQRLEQGNVPLDESVAIYERGEA LKRHCETLLQRAEARIQRITLGADGRAAGTAPLDVA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtccgcagcccggtccgatgccagccgcgcggcagcctccgcacccgccggcccgacc ggaaccgcggatctgccgttcgagaaggccctcgaggaactcgagggcatcgttcagcgc ctggaacagggcaatgtcccgctcgacgaatccgtcgcgatctacgagcggggcgaagcc ctgaagcgccattgcgagacgctgctgcagcgggccgaggcgcgcatccagcgcatcacc ctcggggcggacggacgtgccgccgggacggcgccactcgatgtcgcctga

DBGET integrated database retrieval system