Macadamia integrifolia (macadamia nut): 122072092
Help
Entry
122072092 CDS
T07436
Name
(RefSeq) SKP1-like protein 1B
KO
K03094
S-phase kinase-associated protein 1
Organism
ming
Macadamia integrifolia (macadamia nut)
Pathway
ming03083
Polycomb repressive complex
ming04120
Ubiquitin mediated proteolysis
ming04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
ming00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
122072092
04120 Ubiquitin mediated proteolysis
122072092
09126 Chromosome
03083 Polycomb repressive complex
122072092
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
ming04131
]
122072092
04121 Ubiquitin system [BR:
ming04121
]
122072092
03036 Chromosome and associated proteins [BR:
ming03036
]
122072092
Membrane trafficking [BR:
ming04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
122072092
Ubiquitin system [BR:
ming04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
122072092
Cul7 complex
122072092
Chromosome and associated proteins [BR:
ming03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
122072092
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
122072092
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
122072092
NCBI-ProteinID:
XP_042492571
LinkDB
All DBs
Position
2:3801500..3802352
Genome browser
AA seq
220 aa
AA seq
DB search
MASAKVFVLRTCDGETFEIDESVAYVSETIKNMIEDGFGHDLIPLPNVSSKILLKVIEYC
RKHVSNFESSKKTSNGDEKDKDNDSWKKEKEAVPEVEKDAEEKARVEELKEWETTFIDID
QQVLFDLLQAANYLNIKGLLVMAAEKAASMIRGKTPEQIRETFNIKNDFTPEEYEDIRKK
DAMNDFTPEEYEEIRKKIADNHFTPEEYEQIRKENAWAIE
NT seq
663 nt
NT seq
+upstream
nt +downstream
nt
atggcgtccgctaaggtatttgttttgaggacttgtgatggtgaaaccttcgagatcgat
gaaagcgtcgcttatgtatcagaaactatcaagaacatgatcgaagatggtttcggtcat
gacctgattccattaccaaatgtcagttccaagattctcctgaaggtgatcgagtattgc
aggaaacatgtctcaaattttgaatcttcgaagaagaccagtaatggcgatgagaaagac
aaagataacgattcgtggaagaaagagaaagaagctgtcccagaggttgaaaaagatgca
gaagaaaaagccagagttgaggaactgaaggaatgggaaacgacgttcatagacattgat
caacaggtactttttgatctcttgcaagctgcaaattatctgaacattaagggtttgttg
gttatggctgcggagaaggcagcaagtatgattagggggaagactccggagcagattcga
gagacttttaatattaagaacgattttactccagaagaatatgaagatatcaggaaaaag
gatgctatgaacgattttactccagaagaatatgaagagatcaggaaaaagattgctgac
aaccattttactccagaagaatatgaacagatcaggaaagagaatgcatgggctatcgag
taa
DBGET
integrated database retrieval system