KEGG   Macadamia integrifolia (macadamia nut): 122072092
Entry
122072092         CDS       T07436                                 
Name
(RefSeq) SKP1-like protein 1B
  KO
K03094  S-phase kinase-associated protein 1
Organism
ming  Macadamia integrifolia (macadamia nut)
Pathway
ming03083  Polycomb repressive complex
ming04120  Ubiquitin mediated proteolysis
ming04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ming00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    122072092
   04120 Ubiquitin mediated proteolysis
    122072092
  09126 Chromosome
   03083 Polycomb repressive complex
    122072092
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ming04131]
    122072092
   04121 Ubiquitin system [BR:ming04121]
    122072092
   03036 Chromosome and associated proteins [BR:ming03036]
    122072092
Membrane trafficking [BR:ming04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    122072092
Ubiquitin system [BR:ming04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     122072092
   Cul7 complex
     122072092
Chromosome and associated proteins [BR:ming03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     122072092
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     122072092
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 122072092
NCBI-ProteinID: XP_042492571
LinkDB
Position
2:3801500..3802352
AA seq 220 aa
MASAKVFVLRTCDGETFEIDESVAYVSETIKNMIEDGFGHDLIPLPNVSSKILLKVIEYC
RKHVSNFESSKKTSNGDEKDKDNDSWKKEKEAVPEVEKDAEEKARVEELKEWETTFIDID
QQVLFDLLQAANYLNIKGLLVMAAEKAASMIRGKTPEQIRETFNIKNDFTPEEYEDIRKK
DAMNDFTPEEYEEIRKKIADNHFTPEEYEQIRKENAWAIE
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcgtccgctaaggtatttgttttgaggacttgtgatggtgaaaccttcgagatcgat
gaaagcgtcgcttatgtatcagaaactatcaagaacatgatcgaagatggtttcggtcat
gacctgattccattaccaaatgtcagttccaagattctcctgaaggtgatcgagtattgc
aggaaacatgtctcaaattttgaatcttcgaagaagaccagtaatggcgatgagaaagac
aaagataacgattcgtggaagaaagagaaagaagctgtcccagaggttgaaaaagatgca
gaagaaaaagccagagttgaggaactgaaggaatgggaaacgacgttcatagacattgat
caacaggtactttttgatctcttgcaagctgcaaattatctgaacattaagggtttgttg
gttatggctgcggagaaggcagcaagtatgattagggggaagactccggagcagattcga
gagacttttaatattaagaacgattttactccagaagaatatgaagatatcaggaaaaag
gatgctatgaacgattttactccagaagaatatgaagagatcaggaaaaagattgctgac
aaccattttactccagaagaatatgaacagatcaggaaagagaatgcatgggctatcgag
taa

DBGET integrated database retrieval system