Microbacterium invictum: T9R20_16480 Help Entry T9R20_16480       CDS       T09642                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism minv  Microbacterium invictum Brite KEGG Orthology (KO) [BR:minv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:minv03032]     T9R20_16480    03036 Chromosome and associated proteins [BR:minv03036]     T9R20_16480    03400 DNA repair and recombination proteins [BR:minv03400]     T9R20_16480 DNA replication proteins [BR:minv03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     T9R20_16480 Chromosome and associated proteins [BR:minv03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     T9R20_16480 DNA repair and recombination proteins [BR:minv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       T9R20_16480 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 HU-CCDC81_euk_2 SSB Motif Other DBs NCBI-ProteinID:  WQB70273 UniProt:  A0ABZ0V9H2 LinkDB All DBs Position complement(3426401..3426688) Genome browser AA seq 95 aa AA seqDB search MADKSITKTELVASIASATGQSQSAVSGVLDSLFSTVSEAVAKGSKVSIPGWISFEQVET SARTGRNPQTGEEIKIPAGKRVKVTAGSKLKAAVK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctgacaagtccatcaccaagaccgaactcgtcgcgagcatcgcgagcgccacgggt cagagccagtccgccgtgtccggcgtgctcgactcgctcttctccacggtgtcggaggcg gtggccaagggcagcaaggtctccatccccggatggatctccttcgagcaggtcgagacc tcggctcgcaccggccgcaacccccagacgggtgaagagatcaagatccccgccggcaag cgcgtcaaggtgaccgccggctccaagctcaaggctgcggtgaaataa

DBGET integrated database retrieval system