Minwuia sp. contig_746: ACMVY4_11475 Help Entry ACMVY4_11475      CDS       T11151                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism minw  Minwuia sp. contig_746 Pathway minw01100   Metabolic pathways minw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:minw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACMVY4_11475    00074 Mycolic acid biosynthesis     ACMVY4_11475   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACMVY4_11475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  XOY50522 LinkDB All DBs Position complement(2360424..2360669) Genome browser AA seq 81 aa AA seqDB search MQESDVLPVIEEIMRELTDDPDLNLDRDTTADDVDLWDSVLHVKMMIAIESQFGIRFETE ELNAPELVGELIDLVIAKKQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcaagagagcgacgttctgccggtaatcgaggagatcatgcgggaacttaccgacgat cccgatctcaatctggaccgtgacaccaccgcggacgatgtcgacctctgggattccgtc ctgcatgtgaagatgatgatcgcgatcgagagccagttcggtatccgcttcgagaccgaa gaactcaacgcgccagagttggtcggcgaactgatcgatcttgtcattgccaagaagcag gcctag

DBGET integrated database retrieval system