Microbacterium sp. Nx66: MICNX66_0567 Help Entry MICNX66_0567      CDS       T11414                                  Name (GenBank) protein of unknown function   KO K03741   arsenate reductase (thioredoxin) [EC:1.20.4.4] Organism minx  Microbacterium sp. Nx66 Brite KEGG Orthology (KO) [BR:minx00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     MICNX66_0567 Enzymes [BR:minx01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.4  arsenate reductase (thioredoxin)      MICNX66_0567 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LMWPc Motif Other DBs NCBI-ProteinID:  CAD5138017 LinkDB All DBs Position Nx66:597773..598015 Genome browser AA seq 80 aa AA seqDB search MTDTTTKRSVLFVGVHNAGRSQMAAGCLRDIAGDRVEVRSAGSMPAERSNPTADEAMGVL GIDSTAEQPKSADNRSRAGV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgactgacaccaccaccaagcgctccgtcctcttcgtcggtgtccacaacgccggacgc tcgcagatggcggccggatgtctccgcgacatcgcaggcgaccgcgtcgaggtccgctcg gcgggatccatgcccgccgagcggtccaacccgactgctgacgaggcgatgggcgtgctc ggaatcgacagcacagccgagcagcccaaaagtgctgacaaccgaagccgtgcaggcgtc tga

DBGET integrated database retrieval system