Microbacterium sp. PAMC 28756: AXH82_05780 Help Entry AXH82_05780       CDS       T04312                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism mip  Microbacterium sp. PAMC 28756 Brite KEGG Orthology (KO) [BR:mip00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mip03032]     AXH82_05780    03036 Chromosome and associated proteins [BR:mip03036]     AXH82_05780    03400 DNA repair and recombination proteins [BR:mip03400]     AXH82_05780 DNA replication proteins [BR:mip03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AXH82_05780 Chromosome and associated proteins [BR:mip03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AXH82_05780 DNA repair and recombination proteins [BR:mip03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AXH82_05780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HTH_26 DUF937 Motif Other DBs NCBI-ProteinID:  AMG82942 LinkDB All DBs Position complement(1190156..1190443) Genome browser AA seq 95 aa AA seqDB search MADKSITKTELVASIASATGQSQATVSGVLDSLFATVSDAVAKGSKVSIPGWISFEQVDT AARTGRNPQTGAEIKIPAGKRVKVTAGSKLKAAVK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctgacaagtccatcaccaagaccgagctcgtcgcgagcatcgcttccgccaccggc cagagccaggccaccgtctccggtgtcctcgactcgctgttcgccacggtctccgacgct gtcgccaagggcagcaaggtctccatcccgggctggatctcgttcgagcaggtcgacacg gccgcccgcacgggccgcaacccgcagacgggcgccgagatcaagatcccggccggcaag cgcgtcaaggtgaccgccggttccaagctcaaggctgccgtcaagtaa

DBGET integrated database retrieval system