Microbacterium sp. PAMC 28756: AXH82_06495
Help
Entry
AXH82_06495 CDS
T04312
Name
(GenBank) preprotein translocase YidC
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
mip
Microbacterium sp. PAMC 28756
Pathway
mip02024
Quorum sensing
mip03060
Protein export
mip03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
mip00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
AXH82_06495
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
AXH82_06495
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
AXH82_06495
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
mip03029
]
AXH82_06495
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
mip02044
]
AXH82_06495
Mitochondrial biogenesis [BR:
mip03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
AXH82_06495
Secretion system [BR:
mip02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
AXH82_06495
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
60KD_IMP
Peptidase_S49_N
Motif
Other DBs
NCBI-ProteinID:
AMG83065
LinkDB
All DBs
Position
complement(1332558..1333628)
Genome browser
AA seq
356 aa
AA seq
DB search
MGLDLLFASATPSPEPASGGFDLLGTILWPLKWVVELILVAWHWLLTAVGLPAASGITWV
LSIVGLVIVVRAALIPLFVKQIKSQRKMMEIAPELRKVQEKYRGKKDQLSREAMSRETMA
LYKKHGTTPMSSCLPLLVQMPIFFSLYSVLSDVSKHATQGVGGVGLLSAELTQEFYDAKL
FGVASLHENLGNAIEAQNVTAIIILITLIVLMIASQFFTQLQIISKNLSPEAKTGQAYQM
QKIMLYVLPLGFIFSGVFFPLGVVVYWFISNLWTMGQQFLVIREMPTPGSEAAKAREERL
ARKGKAIDSSGKVVPMAAYEAEQQRLLEEAEKAKAAAPKRQQPVGKKRAKKKGNAS
NT seq
1071 nt
NT seq
+upstream
nt +downstream
nt
gtgggtcttgaccttctgttcgccagtgccacccccagcccggaaccggcatccggcgga
ttcgatctgctcggcacgatcctgtggccgctgaagtgggtcgtcgagctcatcctcgtc
gcctggcactggctgctgacggccgtcggtctccctgcggcgtccggcatcacctgggtc
ctctcgatcgtcggcctcgtgatcgtggtccgtgcagcgctcatcccgctgttcgtgaag
cagatcaagagccagcggaagatgatggaaatcgctcctgaactgcgcaaagtccaggag
aagtaccgcggcaagaaggaccagctctctcgcgaggcgatgagtcgcgagacgatggcg
ctgtacaagaagcacggcacgacgccgatgtcgagctgtctgcccctgctcgtgcagatg
ccgatcttcttctcgctctacagcgtgctgagcgacgtcagcaagcacgcgacgcagggc
gtcggcggtgtcgggctgctgagcgcggaactcacgcaggagttctacgacgccaagctc
ttcggggtcgcgtccctgcacgagaacctcggcaacgcgatcgaggcccagaacgtcacg
gcgatcatcatcctgatcaccctgatcgtcctgatgatcgcgtcgcagttcttcacgcag
ctgcagatcatctcgaagaacctctcgccggaggccaagaccggccaggcgtaccagatg
cagaagatcatgctctacgttctgccgctgggcttcatcttctccggtgtcttcttcccg
ctcggcgtggtcgtgtactggttcatctcgaacctctggaccatggggcagcagttcctc
gtcatccgtgagatgccgactcccggttccgaagccgccaaggcccgcgaagagcggctc
gcccgcaagggcaaggcgatcgactcctccggcaaggtcgtcccgatggctgcatacgag
gccgagcagcagcgtctgctcgaggaggctgagaaggcgaaggcggcggcgccgaagcgg
cagcagccggtcggtaagaagcgtgcgaagaagaaggggaacgcgtcatga
DBGET
integrated database retrieval system