KEGG   Microcystis sp. MC19: B5D77_01180
Entry
B5D77_01180       CDS       T05365                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
miq  Microcystis sp. MC19
Pathway
miq00770  Pantothenate and CoA biosynthesis
miq01100  Metabolic pathways
miq01240  Biosynthesis of cofactors
Module
miq_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:miq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    B5D77_01180
Enzymes [BR:miq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     B5D77_01180
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AVQ70124
LinkDB
Position
240386..240859
AA seq 157 aa
MIAIYPGSFDPVTLGHLDIIERSVPLFERVIVAVLCNPHKNPLFTVEQRIEQIRYCTKHL
KNVEIDSFSGLTVEYARLKGAKVLLRGLRVLSDFEKELQMAHTNKTLWEGIETVFLATTK
EYSFLSSSVVKEIAQFGGSVSHLVPENVSRDIYSYYS
NT seq 474 nt   +upstreamnt  +downstreamnt
atgatcgccatctaccccggcagcttcgatccagttacactcggtcatttagatattatc
gaacgcagtgtgccactattcgagcgagtaatcgtggcagttctctgcaatccccataaa
aaccccctgtttaccgtcgaacaacgcatagaacagatcagatactgcacaaaacacctg
aaaaacgttgagatagacagtttttcaggattaacggttgaatatgccagattgaaagga
gccaaggtacttttgcgggggttgcgagtcctctcggactttgaaaaagaactgcaaatg
gcccataccaataaaaccctctgggaagggatcgaaacggtttttttagccaccaccaaa
gaatatagttttttaagcagtagcgtggttaaagaaatcgctcaattcggtggctccgtc
agccatctagtcccggaaaacgtttctagagatatttactcatactacagttaa

DBGET integrated database retrieval system