Micromonas commoda: MICPUN_61090 Help Entry MICPUN_61090      CDS       T02695                                  Name (RefSeq) predicted protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism mis  Micromonas commoda Pathway mis03020   RNA polymerase mis03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mis00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MICPUN_61090   09124 Replication and repair    03420 Nucleotide excision repair     MICPUN_61090  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mis03021]     MICPUN_61090    03400 DNA repair and recombination proteins [BR:mis03400]     MICPUN_61090 Transcription machinery [BR:mis03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MICPUN_61090   RNA polymerase III system    RNA polymerase III      MICPUN_61090   RNA polymerase I system    RNA polymerase I      MICPUN_61090 DNA repair and recombination proteins [BR:mis03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MICPUN_61090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  8246339 NCBI-ProteinID:  XP_002504163 JGI:  MicpuN3_61090 UniProt:  C1EBJ1 LinkDB All DBs Position 9:join(148668..148702,148971..149352) Genome browser AA seq 138 aa AA seqDB search MDGDGDYDGGDGAYDYDEPAGGDDEPEAEDAEMPEGGVEVLEHAPQQGGGAVTERTTTPY MTKYERARILGTRALQISMNAPVLVQLDGETDPLEIAGKELREKRIPFTVRRYLPDGSWE DWGVDELIVEDPDRRRGL NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atggacggcgacggcgactacgacggcggcgatggcgcctacgactacgacgagcccgcg ggcggcgacgacgaaccggaggctgaggatgcggagatgcccgaggggggcgtcgaggtg ctcgagcacgcccctcagcagggcggcggcgccgtcaccgagcgcaccaccacgccgtac atgaccaagtacgagcgcgcgcgcatcctcggaacccgcgcgctgcagatctcgatgaac gcgccggtgctggtgcagctggacggtgagacggatccgctggagattgccgggaaggag cttcgagagaagcggatcccgttcacggtgagacggtacctacccgacgggtcgtgggag gactggggcgtggacgagctcatcgtggaggacccggacaggcgcagggggctctga

DBGET integrated database retrieval system