Micromonas commoda: MICPUN_73820 Help Entry MICPUN_73820      CDS       T02695                                  Name (RefSeq) predicted protein   KO K09648   mitochondrial inner membrane protease subunit 2 [EC:3.4.21.-] Organism mis  Micromonas commoda Pathway mis03060   Protein export Brite KEGG Orthology (KO) [BR:mis00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MICPUN_73820  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mis01002]     MICPUN_73820   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mis03029]     MICPUN_73820 Peptidases and inhibitors [BR:mis01002]  Serine peptidases   Family S26: signal peptidase I family    MICPUN_73820 Mitochondrial biogenesis [BR:mis03029]  Mitochondrial protein import machinery   Inner mambrane    Other inner membrane factors     MICPUN_73820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_S26 Motif Other DBs NCBI-GeneID:  8243239 NCBI-ProteinID:  XP_002501544 JGI:  MicpuN3_73820 UniProt:  C1E4Z8 LinkDB All DBs Position 4:<1490792..>1491091 Genome browser AA seq 100 aa AA seqDB search LVLLDRVTPRTFSFARGDVVYLRSPSNQDRWVTRRLVALEGDWVTRAADDDVTKVPRGHC WIERVEAGTGVDGDGRAVPLALLDARVSHVLWPPSEVGAV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt ctggtgctcctggacagggtcacgccgcggacgttctcgttcgcgcgcggggacgtggtg tacctgcgctcgccctcgaaccaggatcggtgggtgacgcgcaggctggtggcgctggag ggggactgggtgacgcgcgcggcggacgacgacgtgaccaaggtgccgagggggcactgc tggatcgagagggtcgaggcggggaccggggtggacggggacggccgcgcggtgccgctg gcgctgctcgacgcgagggtatcgcacgtgctgtggccgccgtccgaggttggggcggtg

DBGET integrated database retrieval system