Methylomagnum ishizawai: MishRS11D_17510 Help Entry MishRS11D_17510   CDS       T07434                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism misz  Methylomagnum ishizawai Pathway misz01100   Metabolic pathways misz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:misz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MishRS11D_17510 (acpP)    00074 Mycolic acid biosynthesis     MishRS11D_17510 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MishRS11D_17510 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  BBL74653 LinkDB All DBs Position 1922986..1923216 Genome browser AA seq 76 aa AA seqDB search MSDVAERVKKIVAEQLGVKEEVSNEASFVDDLGADSLDTVELVMALEEEFECEIPDEDAE KITTVQQAIDYIEAHV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgtagctgagcgtgttaagaaaatcgtggccgagcaattgggcgtgaaggaa gaagtctccaacgaagcctccttcgtcgatgatctcggtgccgattcgctggacacggtc gaattggtcatggctttggaagaagaattcgagtgcgagatcccggacgaagacgccgag aagatcaccaccgtgcaacaggccatcgattacatcgaagctcacgtttaa

DBGET integrated database retrieval system