Mitsuaria sp. 7: ABE85_20995 Help Entry ABE85_20995       CDS       T04402                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism miu  Mitsuaria sp. 7 Pathway miu01100   Metabolic pathways miu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:miu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABE85_20995    00074 Mycolic acid biosynthesis     ABE85_20995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABE85_20995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANH69430 LinkDB All DBs Position complement(4773066..4773329) Genome browser AA seq 87 aa AA seqDB search MTNEDIFARLRDILIETFDIEADRITPEARLYEDLDIDSIDAVDLIVKLKPMVGKKLQPE AFKAVRTLQDVVDALQGLIKTPETAGA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgaatgaagacatcttcgcgcgcctgcgcgacatcctgatcgagaccttcgacatc gaagccgatcgcatcacccccgaggctcgcctctacgaagacctcgacatcgactcgatc gatgcggtcgacctgatcgtcaagctcaagccgatggtcggcaagaagctgcagcccgag gccttcaaggccgtgcgcacgctgcaggacgtggtcgatgcgctgcagggtctgatcaag acgccggagacggccggcgcctga

DBGET integrated database retrieval system