Mitsuaria sp. 7: ABE85_21000 Help Entry ABE85_21000       CDS       T04402                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism miu  Mitsuaria sp. 7 Pathway miu01100   Metabolic pathways miu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:miu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABE85_21000    00074 Mycolic acid biosynthesis     ABE85_21000   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABE85_21000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7312 Motif Other DBs NCBI-ProteinID:  ANH69431 UniProt:  A0A1A9HNU1 LinkDB All DBs Position complement(4773357..4773623) Genome browser AA seq 88 aa AA seqDB search MQALERDIKLLLIEALNLEDLTPEQIDAEDALFVTGLGLDSIDALELGLALQKKYGVSMA ADSEETRRHFASIRALARFVAEHGKVAA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgctggaacgtgacatcaaactgctgctgatcgaggccttgaatctcgaggac ctgacgccggagcagatcgacgcggaagacgcgctcttcgtgaccggcctggggttggac tcgatcgacgcgctggagctcgggctggccctgcagaagaaatacggcgtgagcatggcg gcggactcggaagagacgcgccggcatttcgccagcatccgcgcgctggcccgcttcgtt gcggagcacggcaaggtcgcggcctga

DBGET integrated database retrieval system