Microvirga sp. 17 mud 1-3: C4E04_02765 Help Entry C4E04_02765       CDS       T05470                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism miv  Microvirga sp. 17 mud 1-3 Brite KEGG Orthology (KO) [BR:miv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:miv03110]     C4E04_02765 (grxC) Chaperones and folding catalysts [BR:miv03110]  Protein folding catalysts   Protein disulfide isomerase    C4E04_02765 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin SH3BGR GST_N_3 GST_N_2 Thioredoxin_2 Glrx-like TXD17-like_Trx DSBA Thioredoxin_3 GST_N Motif Other DBs NCBI-ProteinID:  AWM88954 UniProt:  A0A2Z3IB39 LinkDB All DBs Position complement(608011..608268) Genome browser AA seq 85 aa AA seqDB search MPPITIYSKSWCPYCAAAKRLLDEKGAAYTEIDIEEEPEKRAEMVQKAGGRTTVPQIFIG ERHVGGCDDLYALDEKGRLEALLQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcccccgatcacgatctactccaagagctggtgcccctattgcgccgccgccaagcga cttcttgacgagaaaggcgccgcctacacggagatcgatatcgaggaagagccggaaaag cgcgccgagatggtccagaaggccggcgggcgcaccaccgtgccgcagatcttcatcggc gagcgccatgtgggcggctgcgacgatctttatgctctggacgagaagggccggcttgag gccttattgcaggcctga

DBGET integrated database retrieval system