Microbacterium sp. XT11: AB663_002486 Help Entry AB663_002486      CDS       T04243                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism mix  Microbacterium sp. XT11 Pathway mix03060   Protein export mix03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mix00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AB663_002486  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AB663_002486  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mix02044]     AB663_002486 Secretion system [BR:mix02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AB663_002486 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Metallopep Motif Other DBs NCBI-ProteinID:  ALX66946 LinkDB All DBs Position 2576705..2576962 Genome browser AA seq 85 aa AA seqDB search MGAFGWPHLLIILAVILLLFGAAKLPALAKSLGQSARVFKGEMKAMKNDDANDANAAGTT GAPAPSTDGTVVRSDSDSSQPPRSA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgggcgcattcggttggcctcacctgctcatcatcctcgccgtcatcctgctgctcttc ggcgcggcgaagctcccggcgctggccaagagcctcggccagtccgcccgcgtgttcaag ggtgagatgaaggcgatgaagaacgacgacgcgaacgacgcgaacgctgccggcacgacc ggcgctcccgcgccgtcgacggacggcacggtcgtacgcagcgacagcgattcgagccag ccgcctcgctccgcgtaa

DBGET integrated database retrieval system