Candidatus Micrarchaeum sp. A_DKE: Micr_00935 Help Entry Micr_00935        CDS       T07038                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism miy  Candidatus Micrarchaeum sp. A_DKE Pathway miy03010   Ribosome Brite KEGG Orthology (KO) [BR:miy00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Micr_00935   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Micr_00935  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:miy03011]     Micr_00935    04121 Ubiquitin system [BR:miy04121]     Micr_00935   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:miy04147]     Micr_00935 Ribosome [BR:miy03011]  Ribosomal proteins   Eukaryotes    Small subunit     Micr_00935   Archaea     Micr_00935 Ubiquitin system [BR:miy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Micr_00935 Exosome [BR:miy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Micr_00935   Exosomal proteins of colorectal cancer cells    Micr_00935 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB EDR4-like_1st YhfH Zn_Ribbon_TF Zn_ribbon_RPB9 Zn_ribbon_13 TackOD1 DZR_2 Zn_ribbon_8 DZR Zn_ribbon_6 Zn_ribbon_Nudix Zn_ribbon_PriA Zn_ribbon_IS1595 Zn_ribbon_PaaD DUF7129 HypA zf_UBZ Ribosomal_L37e zf-Mss51 Lar_restr_allev zf-C2H2_ZN142 Phage_zn_bind_2 Motif Other DBs NCBI-ProteinID:  QRF74399 LinkDB All DBs Position 886485..886658 Genome browser AA seq 57 aa AA seqDB search MAEKKGNEAGKKKQAKKAYKPGKMCPKCGSRMAEHADRYSCGKCGYTEFKSQKKSGA NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggctgaaaaaaaaggcaatgaagcaggaaagaaaaagcaggccaagaaggcttacaag cctggcaagatgtgcccaaagtgcggctcaagaatggctgagcatgcggacaggtattcc tgcgggaagtgcggctataccgaattcaagagccagaaaaagagcggtgcttga

DBGET integrated database retrieval system