Methanocaldococcus bathoardescens: JH146_1193 Help Entry JH146_1193        CDS       T03253                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mjh  Methanocaldococcus bathoardescens Pathway mjh03010   Ribosome Brite KEGG Orthology (KO) [BR:mjh00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     JH146_1193   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     JH146_1193  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mjh03011]     JH146_1193    04121 Ubiquitin system [BR:mjh04121]     JH146_1193 Ribosome [BR:mjh03011]  Ribosomal proteins   Eukaryotes    Large subunit     JH146_1193   Archaea     JH146_1193 Ubiquitin system [BR:mjh04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    JH146_1193 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR Zn_Ribbon_1 DZR_2 Cas12f1-like_TNB DUF6395 Motif Other DBs NCBI-ProteinID:  AIJ06035 UniProt:  A0A076LC68 LinkDB All DBs Position 1180455..1180598 Genome browser AA seq 47 aa AA seqDB search MPFEEAMKRLFMKKICMRCNARNPWRATKCRKCGYKGLRPKAKEPRG NT seq 144 nt NT seq  +upstreamnt  +downstreamnt atgccatttgaagaagcaatgaaaaggttatttatgaaaaagatttgtatgagatgtaat gcaagaaacccttggagagctacaaaatgtagaaaatgtggatacaaaggtttaagacca aaagcaaaagaaccgagaggataa

DBGET integrated database retrieval system