KEGG   Mycobacterium sp. JLS: Mjls_2237
Entry
Mjls_2237         CDS       T00482                                 
Name
(GenBank) ring hydroxylating dioxygenase, alpha subunit
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00624  Polycyclic aromatic hydrocarbon degradation
mjl01100  Metabolic pathways
mjl01120  Microbial metabolism in diverse environments
mjl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mjls_2237
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     Mjls_2237
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABN98023
UniProt: A0A5Q5CFA3
LinkDB
Position
complement(2332127..2333503)
AA seq 458 aa
MTTETTETTGTADATDPYLRRALRDVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVF
LGHESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRGALVCRAEMGNTAHFQC
PYHGWVYSNTGELVGVPAMTEAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTD
YLGDTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELG
MAPGDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMATSYPSPVHKD
LMRRSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVWHPLSHDRMEILSWFLVERDA
PEWLRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGEGLLNYEMGMDLTPLTD
WPGPGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccgaaaccaccggcacagctgacgcgaccgatccctacctgcgg
cgcgcgctgcgcgacgtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtc
agcgatcccgcgctacacacgatcgagatggagcggatcttcgggcgcgcctgggtgttt
ctcggacacgagtcggagttggccaagtccggcgacttcgtcgtgcggcacatcggggcc
gattcggtgatcgtttgccgggacaactccggccgcatccaggcgctgtccaattcttgt
cgccaccgtggtgcgctcgtgtgccgcgctgagatgggaaacaccgcgcacttccaatgc
ccgtaccacggctgggtgtacagcaacaccggagagctcgtcggcgtgccggcgatgacg
gaggcctatcccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtc
gactcgtacgccggattcatcttcggcagcgtcgatccgaaggcgccgagcctgaccgac
tacctcggcgacacgacgttctacctcgacctcattgcgaagaagacagcgggcggtctg
gaggtgataggggcaccgcatcgatgggtgatgtcagcgaactggaagacagccgccgac
aattttgtcggcgactcctaccacaccctctttgctcaccgctcgatggtcgagctaggc
atggcgcccggtgacccaaacttcgcgagcgcaccagcggaaatctcgctgcagaacggc
cacggcgtcggcgtactcggctttccgcccacgctcgccgattttcccgagtacgaggga
taccccgacgaagtcgtcgaccagatggcgacgtcctacccgtcgccggtacacaaggac
ctgatgcgacgctcatcctttattcacggcaccgtgttcccgaatttgtcgttcatcaac
gtgaccctcgcgcaggaccacatgtcgccccctacccccttcatcacgttccgggtatgg
catccgctctcccatgatcggatggagatcctctcctggttcctggtcgaacgcgatgct
ccggaatggttgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccaggtggg
gttttcgaacaggacgacgccgaggcatggaaggccatcaccgaatctgtccagggcccg
ttcgccggtgaaggcctgctgaactacgaaatgggcatggacttgactccgctcaccgac
tggccagggccgggagaggccctcccgagcgggtacgccgagcagaatcagcggcggttt
tgggggagatggctggaatacatgggtcagcctcccgcattcggcgggcgtgcttga

DBGET integrated database retrieval system