Mesobacillus jeotgali: FOF60_05495 Help Entry FOF60_05495       CDS       T08547                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mjo  Mesobacillus jeotgali Pathway mjo00020   Citrate cycle (TCA cycle) mjo00720   Other carbon fixation pathways mjo01100   Metabolic pathways mjo01110   Biosynthesis of secondary metabolites mjo01120   Microbial metabolism in diverse environments mjo01200   Carbon metabolism mjo01210   2-Oxocarboxylic acid metabolism Module mjo_M00009   Citrate cycle (TCA cycle, Krebs cycle) mjo_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:mjo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     FOF60_05495   09102 Energy metabolism    00720 Other carbon fixation pathways     FOF60_05495 Enzymes [BR:mjo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      FOF60_05495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_7 Fer4_2 Fer4_21 Fer4_6 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_8 Fer4_3 Fer4_17 Fer4_18 Fer4_22 DJ-1_PfpI Fer4_ETF_QO Motif Other DBs NCBI-ProteinID:  UYZ23010 LinkDB All DBs Position 1101766..1101996 Genome browser AA seq 76 aa AA seqDB search MEQKVVFNEETCKSCKLCVNVCPTNVIYLADYLNEKGYRPAIVTDQENCISCGKCAQMCP DSVITVYRPEKVRKSV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtggagcagaaagttgtttttaacgaggagacttgcaagtcatgcaagctgtgcgtgaat gtttgtccgacaaatgtgatttatcttgctgattacttgaatgaaaaaggctaccggccg gcgattgtgacagaccaggaaaattgcatcagctgcggcaagtgcgcgcaaatgtgtccg gattcggtaatcactgtctataggccagaaaaggtaaggaaatctgtttag

DBGET integrated database retrieval system