Mesobacillus jeotgali: FOF60_08580 Help Entry FOF60_08580       CDS       T08547                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mjo  Mesobacillus jeotgali Pathway mjo01100   Metabolic pathways mjo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mjo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FOF60_08580    00074 Mycolic acid biosynthesis     FOF60_08580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FOF60_08580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Guanylate_cyc DUF1493 Motif Other DBs NCBI-ProteinID:  UYZ23576 LinkDB All DBs Position 1734356..1734589 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVDESQVTLEASFKDDLGADSLDVVELVMELEDEFDMEISDDDA EKIGTVGDAVNYINSQK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagacgttttagaacgcgtaacaaaaattattgttgaccgtttgggagtagatgaa tctcaagtaactttagaagcatcttttaaagatgatcttggtgctgattcccttgatgtt gttgaattggtaatggaactagaagatgagttcgacatggaaatttctgatgatgatgct gaaaaaatcggtacagttggtgacgctgttaactacataaatagccaaaagtaa

DBGET integrated database retrieval system