Maniola jurtina (meadow brown): 123868785 Help Entry 123868785         CDS       T09254                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism mju  Maniola jurtina (meadow brown) Pathway mju04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mju00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     123868785  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mju04121]     123868785    03400 DNA repair and recombination proteins [BR:mju03400]     123868785 Ubiquitin system [BR:mju04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      123868785    Cul5 complex      123868785 DNA repair and recombination proteins [BR:mju03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      123868785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  123868785 NCBI-ProteinID:  XP_045767352 EnsemblRapid:  ENSMJUG00000006732 LinkDB All DBs Position 10:complement(14551801..14559656) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVPPPSQMLFNKDSQLMEDEKTLAE YGLTSATAKAQCPAPIGLALRKENGEFEALDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtctttctaatgattaggcgaaaaaaattaaccatcttcacagacgccaaggat acaacgactgttctagaactgaagaaaatgatagaggggatcttgaaggtgcctccaccc agtcagatgctcttcaacaaagatagccagctgatggaggacgagaagactctggcagag tatgggctcacttcagccacagccaaggctcaatgtcccgcccccattggacttgctcta agaaaagaaaacggtgaatttgaggctctggatttgactccatactcctcgccccccgac ctgcctgacgtgatgaagtcccaggaaaccaatggacaggaacagatggaccaacactaa

DBGET integrated database retrieval system