Maniola jurtina (meadow brown): 123872138 Help Entry 123872138         CDS       T09254                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mju  Maniola jurtina (meadow brown) Pathway mju04013   MAPK signaling pathway - fly mju04145   Phagosome mju04148   Efferocytosis mju04310   Wnt signaling pathway mju04620   Toll-like receptor signaling pathway mju05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mju00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     123872138    04310 Wnt signaling pathway     123872138  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123872138    04148 Efferocytosis     123872138  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123872138  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123872138  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mju04131]     123872138   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mju04147]     123872138    04031 GTP-binding proteins [BR:mju04031]     123872138 Membrane trafficking [BR:mju04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123872138  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123872138   Macropinocytosis    Ras GTPases     123872138  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123872138 Exosome [BR:mju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123872138   Exosomal proteins of other body fluids (saliva and urine)    123872138   Exosomal proteins of colorectal cancer cells    123872138   Exosomal proteins of bladder cancer cells    123872138 GTP-binding proteins [BR:mju04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123872138 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  123872138 NCBI-ProteinID:  XP_045772251 LinkDB All DBs Position 14:11209474..11254293 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLTPIIYTSGLGMSKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV QPVKVKRKCSIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgattaagtgtgtcgttgttggcgatggagctgtcggtaaaacttgtcttctc atcagttacaccacaaacgccttccccggggagtacataccaacagtatttgacaactac tccgcaaatgtaatggtagacggaaaacccattaatctgggactctgggatacggcgggg caggaggactacgatcgactgcggccactctcctacccacagacagacgtgttcctcata tgcttctcactggtgaacccagcttccttcgagaacgtgcgtgcaaagtggtacccagaa gtgaggcatcactgcccgtcaacgcccatcatcctggttggaacgaagctcgaccttcgc gaagacaaggacacgattgaaaagctgaaggacaaaaaattaactcccatcatttataca tcaggcctaggcatgtcgaaggagatcggtgcagtgaagtacctagaatgctcggcgctg acgcagaaggggctgaagacggtgttcgacgaggccatccgcgccgtgctgtgccccgtg cagcccgtcaaggtgaagcggaagtgttccatactgtaa

DBGET integrated database retrieval system