Maniola jurtina (meadow brown): 123880583 Help Entry 123880583         CDS       T09254                                  Name (RefSeq) bombyxin A-2 homolog   KO K04526   insulin Organism mju  Maniola jurtina (meadow brown) Pathway mju04068   FoxO signaling pathway mju04081   Hormone signaling mju04140   Autophagy - animal mju04150   mTOR signaling pathway mju04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:mju00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     123880583    04150 mTOR signaling pathway     123880583   09133 Signaling molecules and interaction    04081 Hormone signaling     123880583  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     123880583  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     123880583  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mju04052]     123880583 Cytokines and neuropeptides [BR:mju04052]  Neuropeptides   Unclassified    123880583 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  123880583 NCBI-ProteinID:  XP_045784735 LinkDB All DBs Position Z:12730048..12732308 Genome browser AA seq 129 aa AA seqDB search MMRPKIKCLSRKCLFTVGLKVCKMNITLVCLMLIVSTGMSHLEERARTYCGRALVYALSI SCERAKAEPPMFMPRPWPTTLTQSGSKLHEEEVELVDEVEVEEQEPRSSIVEVCCEKPCF ISELLAFCQ NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgatgcggcctaagataaagtgcttgtctagaaaatgcctattcactgtcggcttgaag gtgtgcaaaatgaacatcacactggtctgtctaatgttgatagtttctacggggatgtca cacctagaggagagagcacggacatattgtggtcgagccctagtctatgcgttgtccatt tcctgtgagagagccaaggctgagccaccgatgtttatgccgagaccttggccaactaca ctcactcaatctgggtcgaaattacatgaggaagaggtggaattggttgatgaggttgaa gtggaagaacaagaaccccggagcagcatagtcgaggtgtgctgtgagaaaccgtgcttc ataagcgagctattagccttctgccaatag

DBGET integrated database retrieval system