Maniola jurtina (meadow brown): 123881147 Help Entry 123881147         CDS       T09254                                  Name (RefSeq) dynein axonemal light chain 4   KO K10412   dynein axonemal light chain 4 Organism mju  Maniola jurtina (meadow brown) Pathway mju04814   Motor proteins Brite KEGG Orthology (KO) [BR:mju00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     123881147  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mju03037]     123881147    04812 Cytoskeleton proteins [BR:mju04812]     123881147 Cilium and associated proteins [BR:mju03037]  Motile cilia and associated proteins   Dynein arm    123881147 Cytoskeleton proteins [BR:mju04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      123881147 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  123881147 NCBI-ProteinID:  XP_045785718 LinkDB All DBs Position 3:complement(1668337..1671713) Genome browser AA seq 105 aa AA seqDB search MAEEGVATVGAAEKVIHTYPLIRHSDMSEEMRVEAMELSVTACEKYSQNNELAARMVKES MDKKFGPAFHVVVGESYGFEITYECTTICYMYFGGNQAICIWKCS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggctgaggaaggagtggcaactgtgggggcagctgaaaaagtgatacacacttatccg cttataaggcattcggacatgtcggaagagatgagagtggaggccatggagctgtccgtg acagcgtgcgagaagtactcccagaacaacgagctggcggcgcggatggtcaaggaatct atggacaagaagttcggcccggcgttccacgtggtcgtcggcgaaagctacggcttcgaa atcacgtacgagtgtacgaccatttgttacatgtatttcggcggtaaccaagcgatctgc atatggaagtgttcttga

DBGET integrated database retrieval system