Manis javanica (Malayan pangolin): 108383250 Help Entry 108383250         CDS       T06054                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04014   Ras signaling pathway mjv04015   Rap1 signaling pathway mjv04022   cGMP-PKG signaling pathway mjv04024   cAMP signaling pathway mjv04062   Chemokine signaling pathway mjv04071   Sphingolipid signaling pathway mjv04072   Phospholipase D signaling pathway mjv04081   Hormone signaling mjv04144   Endocytosis mjv04150   mTOR signaling pathway mjv04270   Vascular smooth muscle contraction mjv04310   Wnt signaling pathway mjv04350   TGF-beta signaling pathway mjv04360   Axon guidance mjv04510   Focal adhesion mjv04517   IgSF CAM signaling mjv04519   Cadherin signaling mjv04520   Adherens junction mjv04530   Tight junction mjv04611   Platelet activation mjv04621   NOD-like receptor signaling pathway mjv04625   C-type lectin receptor signaling pathway mjv04660   T cell receptor signaling pathway mjv04670   Leukocyte transendothelial migration mjv04722   Neurotrophin signaling pathway mjv04810   Regulation of actin cytoskeleton mjv04921   Oxytocin signaling pathway mjv04928   Parathyroid hormone synthesis, secretion and action mjv04972   Pancreatic secretion mjv05100   Bacterial invasion of epithelial cells mjv05132   Salmonella infection mjv05133   Pertussis mjv05135   Yersinia infection mjv05152   Tuberculosis mjv05163   Human cytomegalovirus infection mjv05200   Pathways in cancer mjv05203   Viral carcinogenesis mjv05205   Proteoglycans in cancer mjv05206   MicroRNAs in cancer mjv05210   Colorectal cancer mjv05417   Lipid and atherosclerosis mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     108383250 (RHOA)    04015 Rap1 signaling pathway     108383250 (RHOA)    04310 Wnt signaling pathway     108383250 (RHOA)    04350 TGF-beta signaling pathway     108383250 (RHOA)    04072 Phospholipase D signaling pathway     108383250 (RHOA)    04071 Sphingolipid signaling pathway     108383250 (RHOA)    04024 cAMP signaling pathway     108383250 (RHOA)    04022 cGMP-PKG signaling pathway     108383250 (RHOA)    04150 mTOR signaling pathway     108383250 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     108383250 (RHOA)    04517 IgSF CAM signaling     108383250 (RHOA)    04519 Cadherin signaling     108383250 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108383250 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     108383250 (RHOA)    04520 Adherens junction     108383250 (RHOA)    04530 Tight junction     108383250 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108383250 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108383250 (RHOA)    04621 NOD-like receptor signaling pathway     108383250 (RHOA)    04625 C-type lectin receptor signaling pathway     108383250 (RHOA)    04660 T cell receptor signaling pathway     108383250 (RHOA)    04670 Leukocyte transendothelial migration     108383250 (RHOA)    04062 Chemokine signaling pathway     108383250 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     108383250 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     108383250 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     108383250 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     108383250 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     108383250 (RHOA)   09158 Development and regeneration    04360 Axon guidance     108383250 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108383250 (RHOA)    05206 MicroRNAs in cancer     108383250 (RHOA)    05205 Proteoglycans in cancer     108383250 (RHOA)    05203 Viral carcinogenesis     108383250 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     108383250 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     108383250 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     108383250 (RHOA)    05135 Yersinia infection     108383250 (RHOA)    05133 Pertussis     108383250 (RHOA)    05152 Tuberculosis     108383250 (RHOA)    05100 Bacterial invasion of epithelial cells     108383250 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108383250 (RHOA)    05418 Fluid shear stress and atherosclerosis     108383250 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mjv04131]     108383250 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108383250 (RHOA)    04031 GTP-binding proteins [BR:mjv04031]     108383250 (RHOA) Membrane trafficking [BR:mjv04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     108383250 (RHOA) Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108383250 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    108383250 (RHOA)   Exosomal proteins of colorectal cancer cells    108383250 (RHOA)   Exosomal proteins of bladder cancer cells    108383250 (RHOA) GTP-binding proteins [BR:mjv04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     108383250 (RHOA) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  108383250 NCBI-ProteinID:  XP_017495121 LinkDB All DBs Position 3:complement(1290329..1343249) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgttttcagcaaggaccagttcccagaggtgtatgtgcccaccgtgtttgag aactatgtggcagacatcgaggtggatgggaagcaggtggagctggctttgtgggacaca gctgggcaggaggattacgatcgcttgcggcccctctcctacccggacaccgacgtcata ctgatgtgtttctccatcgacagccctgatagcttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgccccaacgtgcccatcatcctggttgggaataagaaggat cttcggaatgatgagcacaccaggcgggaactggccaagatgaaacaggagccagtaaaa ccggaagaaggcagagacatggctaacaggatcggcgcctttgggtacatggagtgctcc gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaagaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system