Manis javanica (Malayan pangolin): 108383567 Help Entry 108383567         CDS       T06054                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04060   Cytokine-cytokine receptor interaction mjv04061   Viral protein interaction with cytokine and cytokine receptor mjv04151   PI3K-Akt signaling pathway mjv04625   C-type lectin receptor signaling pathway mjv04630   JAK-STAT signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04672   Intestinal immune network for IgA production mjv04940   Type I diabetes mellitus mjv05135   Yersinia infection mjv05142   Chagas disease mjv05162   Measles mjv05166   Human T-cell leukemia virus 1 infection mjv05171   Coronavirus disease mjv05200   Pathways in cancer mjv05320   Autoimmune thyroid disease mjv05321   Inflammatory bowel disease mjv05330   Allograft rejection mjv05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108383567 (IL2)    04151 PI3K-Akt signaling pathway     108383567 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108383567 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     108383567 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108383567 (IL2)    04660 T cell receptor signaling pathway     108383567 (IL2)    04658 Th1 and Th2 cell differentiation     108383567 (IL2)    04659 Th17 cell differentiation     108383567 (IL2)    04672 Intestinal immune network for IgA production     108383567 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108383567 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108383567 (IL2)    05171 Coronavirus disease     108383567 (IL2)    05162 Measles     108383567 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     108383567 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     108383567 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     108383567 (IL2)    05321 Inflammatory bowel disease     108383567 (IL2)    05330 Allograft rejection     108383567 (IL2)    05332 Graft-versus-host disease     108383567 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108383567 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108383567 (IL2)    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108383567 (IL2) Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Interleukins    108383567 (IL2) Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Cytokines    108383567 (IL2) SSDB OrthologParalogGFIT Motif Pfam:  IL2 PSY Motif Other DBs NCBI-GeneID:  108383567 NCBI-ProteinID:  XP_017495639 LinkDB All DBs Position 5:70095223..70115556 Genome browser AA seq 154 aa AA seqDB search MYKVQLLSCIALTLALVANSAPTSSSTKETEQQLEQLLLDLRLLLNGVNNYENPKLSRML TFTFYVPKKATELKHLQCLVEELKPVEGVLHLAQSKNFHLRDIKELMSNINVTVLELKGS ETSFTCEYDDETENIVEFLNKWITFCQSIFSTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaaggtgcagctcttgtcctgcattgcactaactctcgcgcttgtcgcaaacagt gcacctacttcaagctctacaaaggaaactgagcaacaactggagcagttactgctagat ttacggttgcttttgaatggagttaataattatgagaaccccaaactctccaggatgctc acatttacattttatgtgcccaagaaggccacagaattgaaacatcttcagtgtctagta gaagaactcaaacctgtggagggagtgctacatttagctcaaagcaaaaactttcacttg agagatatcaaagaattaatgagcaatatcaacgtaactgttctggaactaaagggctct gaaacaagtttcacatgtgaatatgatgatgagacagaaaacattgtagaatttctaaac aaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system