Manis javanica (Malayan pangolin): 108386671 Help Entry 108386671         CDS       T06054                                  Name (RefSeq) histone H2A.J   KO K11251   histone H2A Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv03082   ATP-dependent chromatin remodeling mjv04217   Necroptosis mjv04613   Neutrophil extracellular trap formation mjv05034   Alcoholism mjv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mjv00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     108386671  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108386671  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     108386671  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     108386671   09165 Substance dependence    05034 Alcoholism     108386671  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mjv03036]     108386671   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108386671 Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108386671 Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108386671 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  108386671 NCBI-ProteinID:  XP_017500149 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESQKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggaaagcagggcggcaaagtgcgcgcaaaggccaaatcccggtcctcc cgcgccggcctgcagttcccggtgggccgagtgcacagactgctgcgcaaaggtaactac gcggagcgagtaggcgccggggcgccggtgtacctggctgccgtgttggagtacctgaca gccgagatcttggagttggctggcaacgccgcgcgtgacaacaagaagaccagaattatc cctcgacacctgcaacttgccatccgcaacgacgaggagctaaacaaactgctggggaaa gtgaccatcgcccagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaaa accgagagtcagaaggccaagagcaagtga

DBGET integrated database retrieval system