Manis javanica (Malayan pangolin): 108387268 Help Entry 108387268         CDS       T06054                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04072   Phospholipase D signaling pathway mjv04140   Autophagy - animal mjv04150   mTOR signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04152   AMPK signaling pathway mjv04211   Longevity regulating pathway mjv04218   Cellular senescence mjv04714   Thermogenesis mjv04910   Insulin signaling pathway mjv04919   Thyroid hormone signaling pathway mjv05163   Human cytomegalovirus infection mjv05165   Human papillomavirus infection mjv05168   Herpes simplex virus 1 infection mjv05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     108387268 (RHEB)    04151 PI3K-Akt signaling pathway     108387268 (RHEB)    04152 AMPK signaling pathway     108387268 (RHEB)    04150 mTOR signaling pathway     108387268 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108387268 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     108387268 (RHEB)   09149 Aging    04211 Longevity regulating pathway     108387268 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     108387268 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     108387268 (RHEB)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     108387268 (RHEB)    05165 Human papillomavirus infection     108387268 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mjv04031]     108387268 (RHEB) GTP-binding proteins [BR:mjv04031]  Small (monomeric) G-proteins   Ras Family    Rheb     108387268 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  108387268 NCBI-ProteinID:  XP_036855305 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tctttgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccatagaa aacacttttacaaaattgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattccatcttccctcagacgtactccatagatattaatggt tatattcttgtatattccgttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaaattgctggacatggtggggaaagtacaaatacctattatgttggttggaaataag aaagacctgcatatggaaagggtgatcagctatgaagaagggaaagcgctagcagagtca tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaattgatggagctgcttcacaagggaagtcttcc tgctcggtgatgtaa

DBGET integrated database retrieval system