Manis javanica (Malayan pangolin): 108388277 Help Entry 108388277         CDS       T06054                                  Name (RefSeq) interferon alpha-1/13-like   KO K05414   interferon alpha Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04060   Cytokine-cytokine receptor interaction mjv04151   PI3K-Akt signaling pathway mjv04217   Necroptosis mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04622   RIG-I-like receptor signaling pathway mjv04623   Cytosolic DNA-sensing pathway mjv04630   JAK-STAT signaling pathway mjv04650   Natural killer cell mediated cytotoxicity mjv04936   Alcoholic liver disease mjv05152   Tuberculosis mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05162   Measles mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05165   Human papillomavirus infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05168   Herpes simplex virus 1 infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05200   Pathways in cancer mjv05320   Autoimmune thyroid disease mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108388277    04151 PI3K-Akt signaling pathway     108388277   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108388277  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108388277  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108388277    04621 NOD-like receptor signaling pathway     108388277    04622 RIG-I-like receptor signaling pathway     108388277    04623 Cytosolic DNA-sensing pathway     108388277    04650 Natural killer cell mediated cytotoxicity     108388277  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108388277   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108388277    05161 Hepatitis B     108388277    05160 Hepatitis C     108388277    05171 Coronavirus disease - COVID-19     108388277    05164 Influenza A     108388277    05162 Measles     108388277    05168 Herpes simplex virus 1 infection     108388277    05163 Human cytomegalovirus infection     108388277    05167 Kaposi sarcoma-associated herpesvirus infection     108388277    05169 Epstein-Barr virus infection     108388277    05165 Human papillomavirus infection     108388277   09171 Infectious disease: bacterial    05152 Tuberculosis     108388277   09163 Immune disease    05320 Autoimmune thyroid disease     108388277   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108388277   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     108388277  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108388277 Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Interferons    108388277 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Lyase_8_N Motif Other DBs NCBI-GeneID:  108388277 NCBI-ProteinID:  XP_017502214 LinkDB All DBs Position Unknown AA seq 171 aa AA seqDB search SVAQIYLLVAGVMLCCIPTCSPGSVLPWYHSLENRELFKLLQQLKSIPSQSCLNDRTDFK FPWKRGTITQIRMTQGICFHHQILQQIFNLFSTKESHAVWNNALLHKILFSLDHSLEQLQ HREEENLACPHLEIVVCKYFQGINLHLKEKEYSPCAWEVVRREIKMCLSLI NT seq 516 nt NT seq  +upstreamnt  +downstreamnt tctgtggcccagatctatttgctcgtggccggagtgatgctctgctgcatccctacctgc tctcctggctcggtcttgccttggtaccatagcctagaaaacagggaactcttcaaactt ctgcaacaactgaaaagtattccctctcagtcctgcctaaatgacagaaccgacttcaaa ttcccttggaaaagagggactatcactcaaatacggatgacacaaggcatttgcttccac catcagatactccagcagatcttcaacctcttcagcacaaaggaaagccatgccgtttgg aacaacgctcttctccataaaatactcttcagccttgatcacagcctggaacaactgcag cacagggaagaagaaaatctggcctgtcctcacttggaaattgttgtctgcaaatatttc caaggaatcaatctccatctgaaggaaaaagaatacagcccttgtgcctgggaggttgtc agaagggaaattaaaatgtgcctttctctcatttga

DBGET integrated database retrieval system