Manis javanica (Malayan pangolin): 108388379 Help Entry 108388379         CDS       T06054                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04066   HIF-1 signaling pathway mjv04120   Ubiquitin mediated proteolysis mjv05170   Human immunodeficiency virus 1 infection mjv05200   Pathways in cancer mjv05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mjv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     108388379 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     108388379 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108388379 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     108388379 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108388379 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mjv04121]     108388379 (ELOB)    03400 DNA repair and recombination proteins [BR:mjv03400]     108388379 (ELOB) Ubiquitin system [BR:mjv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      108388379 (ELOB)    Cul5 complex      108388379 (ELOB) DNA repair and recombination proteins [BR:mjv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      108388379 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  108388379 NCBI-ProteinID:  XP_036880409 LinkDB All DBs Position 10:complement(3690566..3694916) Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADEAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcaccgtgttcgagctgaagcgcatcgtcgagggcatcctcaagcggccgcccgac gagcagcggctgtacaaggacgatcagcttctggacgacggcaagacactgggcgagtgt ggtttcaccagtcagaccgcgcggccgcaggccccagccaccgtggggcttgccttccgg gcagatgaggcgtttgaggccctgcgcattgagcccttctccagcccaccggagctgcct gacgtgatgaagcctcaggactcaggaagcagtgccaacgaacaagcagtgcagtga

DBGET integrated database retrieval system