Manis javanica (Malayan pangolin): 108390095 Help Entry 108390095         CDS       T06054                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv03030   DNA replication mjv03082   ATP-dependent chromatin remodeling mjv03410   Base excision repair mjv03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mjv00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     108390095 (POLE3)    03410 Base excision repair     108390095 (POLE3)    03420 Nucleotide excision repair     108390095 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     108390095 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mjv03032]     108390095 (POLE3)    03036 Chromosome and associated proteins [BR:mjv03036]     108390095 (POLE3)    03400 DNA repair and recombination proteins [BR:mjv03400]     108390095 (POLE3) Enzymes [BR:mjv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      108390095 (POLE3) DNA replication proteins [BR:mjv03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     108390095 (POLE3) Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     108390095 (POLE3) DNA repair and recombination proteins [BR:mjv03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       108390095 (POLE3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C BUD22 CIS_TMP DUF5427 SpoU_methylase DUF4746 RNA_pol_3_Rpc31 Myc_N Pox_Ag35 CDC45 V_ATPase_I Motif Other DBs NCBI-GeneID:  108390095 NCBI-ProteinID:  XP_017504267 LinkDB All DBs Position 2:19633426..19636023 Genome browser AA seq 147 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNATDVLAAMEEMEFQRFITPLKEALEAYRREQKGKKEASEQKKKDKDKKPDSEEQD KSRDEDNDEEEERLEEEEQNEEEDVDN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcagagaggcccgaggacctaaacctgcccaatgccgtcatcaccaggatcatcaag gaggcgctcccggacggtgtcaacatttccaaggaggcccggagcgccatctcccgcgct gccagcgtcttcgtgctgtacgccacatcctgtgccaacaactttgccatgaaaggaaaa cgcaagacacttaacgccactgatgtgctcgcagccatggaggagatggagttccagcgg ttcattaccccattaaaagaagctttggaagcatataggagggagcagaaaggcaagaag gaagcttcagaacaaaagaagaaggacaaagacaaaaaaccagattcggaagaacaagac aagagcagggatgaggacaatgatgaagaggaggaaaggctggaggaagaagaacagaat gaggaggaggacgtggacaactga

DBGET integrated database retrieval system