Entry |
|
Symbol |
CDC42
|
Name |
(RefSeq) cell division control protein 42 homolog isoform X1
|
KO |
K04393 | cell division control protein 42 |
|
Organism |
mjv Manis javanica (Malayan pangolin)
|
Pathway |
mjv04660 | T cell receptor signaling pathway |
mjv04666 | Fc gamma R-mediated phagocytosis |
mjv04670 | Leukocyte transendothelial migration |
mjv04810 | Regulation of actin cytoskeleton |
mjv04932 | Non-alcoholic fatty liver disease |
mjv04933 | AGE-RAGE signaling pathway in diabetic complications |
mjv05100 | Bacterial invasion of epithelial cells |
|
Brite |
KEGG Orthology (KO) [BR:mjv00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
108391531 (CDC42)
04014 Ras signaling pathway
108391531 (CDC42)
04015 Rap1 signaling pathway
108391531 (CDC42)
04370 VEGF signaling pathway
108391531 (CDC42)
09140 Cellular Processes
09141 Transport and catabolism
04144 Endocytosis
108391531 (CDC42)
09144 Cellular community - eukaryotes
04510 Focal adhesion
108391531 (CDC42)
04520 Adherens junction
108391531 (CDC42)
04530 Tight junction
108391531 (CDC42)
09142 Cell motility
04810 Regulation of actin cytoskeleton
108391531 (CDC42)
09150 Organismal Systems
09151 Immune system
04660 T cell receptor signaling pathway
108391531 (CDC42)
04666 Fc gamma R-mediated phagocytosis
108391531 (CDC42)
04670 Leukocyte transendothelial migration
108391531 (CDC42)
04062 Chemokine signaling pathway
108391531 (CDC42)
09152 Endocrine system
04912 GnRH signaling pathway
108391531 (CDC42)
09156 Nervous system
04722 Neurotrophin signaling pathway
108391531 (CDC42)
09158 Development and regeneration
04360 Axon guidance
108391531 (CDC42)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
108391531 (CDC42)
05205 Proteoglycans in cancer
108391531 (CDC42)
05203 Viral carcinogenesis
108391531 (CDC42)
09162 Cancer: specific types
05212 Pancreatic cancer
108391531 (CDC42)
05211 Renal cell carcinoma
108391531 (CDC42)
09172 Infectious disease: viral
05165 Human papillomavirus infection
108391531 (CDC42)
09171 Infectious disease: bacterial
05132 Salmonella infection
108391531 (CDC42)
05135 Yersinia infection
108391531 (CDC42)
05100 Bacterial invasion of epithelial cells
108391531 (CDC42)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
108391531 (CDC42)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
108391531 (CDC42)
04933 AGE-RAGE signaling pathway in diabetic complications
108391531 (CDC42)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:mjv04131]
108391531 (CDC42)
03036 Chromosome and associated proteins [BR:mjv03036]
108391531 (CDC42)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:mjv04147]
108391531 (CDC42)
04031 GTP-binding proteins [BR:mjv04031]
108391531 (CDC42)
Membrane trafficking [BR:mjv04131]
Exocytosis
Small GTPases and associated proteins
Rho GTPases
108391531 (CDC42)
Endocytosis
Lipid raft mediated endocytosis
GRAF1-dependent endocytosis
108391531 (CDC42)
Macropinocytosis
Ras GTPases
108391531 (CDC42)
Chromosome and associated proteins [BR:mjv03036]
Eukaryotic type
Centrosome formation proteins
Other centrosome associated proteins
108391531 (CDC42)
Exosome [BR:mjv04147]
Exosomal proteins
Exosomal proteins of microglial cells
108391531 (CDC42)
Exosomal proteins of breast milk
108391531 (CDC42)
GTP-binding proteins [BR:mjv04031]
Small (monomeric) G-proteins
Rho Family
Rac/Cdc42 [OT]
108391531 (CDC42)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL |
NT seq |
576 nt +upstreamnt +downstreamnt
atgcagacaattaagtgtgttgttgtgggtgatggtgctgttggtaaaacatgcctcctg
atatcttacacaacaaacaagtttccatctgagtatgtaccgactgtttttgacaactat
gcagtcacagtaatgattggtggagagccgtataccctcggactttttgatactgcaggt
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtacctgag
ataactcaccattgtccaaagacccctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctacaattgagaaacttgccaagaacaaacagaagccgatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acgcagaaaggcctaaagaatgtatttgacgaagcaatactggctgccctggagcctccg
gaaccgaagaagagccgcaggtgtgtgctgctatga |