Manis javanica (Malayan pangolin): 108391717 Help Entry 108391717         CDS       T06054                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04621   NOD-like receptor signaling pathway mjv05012   Parkinson disease mjv05132   Salmonella infection mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108391717 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108391717 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     108391717 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108391717 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mjv03110]     108391717 (TXN) Chaperones and folding catalysts [BR:mjv03110]  Protein folding catalysts   Protein disulfide isomerase    108391717 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_7 Glutaredoxin Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  108391717 NCBI-ProteinID:  XP_017506943 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIDSKFAFQEALDGAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaaacagatcgacagcaagtttgcttttcaggaagccttggacggtgcaggagat aaacttgtagtagtagacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttcttccattccctctctgaaaagtattccaatgtggtgttccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccaatttttt aaaaagggacaaaaggtcggtgaattttctggagctaataaggaaaaacttgaagctacc attaatgaattaatctaa

DBGET integrated database retrieval system