Manis javanica (Malayan pangolin): 108392553 Help Entry 108392553         CDS       T06054                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04015   Rap1 signaling pathway mjv04810   Regulation of actin cytoskeleton mjv05014   Amyotrophic lateral sclerosis mjv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     108392553 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     108392553 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108392553 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108392553 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mjv04131]     108392553 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mjv04812]     108392553 (PFN4)    04147 Exosome [BR:mjv04147]     108392553 (PFN4) Membrane trafficking [BR:mjv04131]  Others   Actin-binding proteins    Others     108392553 (PFN4) Cytoskeleton proteins [BR:mjv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      108392553 (PFN4) Exosome [BR:mjv04147]  Exosomal proteins   Proteins found in most exosomes    108392553 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  108392553 NCBI-ProteinID:  XP_017508372 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDGAALIKLHERSLCVASPGFSVMPRDVRTLVNGFAKNPLQAR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatactctcctgggaaccaagcatgtggacggt gcagccctcattaaactccacgagaggagcctgtgtgtagcatcaccaggatttagtgta atgcccagggacgtccgaacacttgtgaatggatttgccaagaaccctttacaggccaga agagaaggattgtatttcaaggaaaaggactacaaatgtgtccgagcagatgactattct ctttatgctaagaacgaaaatactggtgtggttgttgtgaagacccatctgtaccttctg gtagcaacttacactgagggcatgtatcctagtgtttgtgtggaagccacagagaaactg ggagaatatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system