Manis javanica (Malayan pangolin): 108392604 Help Entry 108392604         CDS       T06054                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04814   Motor proteins mjv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mjv00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     108392604 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108392604 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mjv03037]     108392604 (DYNLT1)    04812 Cytoskeleton proteins [BR:mjv04812]     108392604 (DYNLT1) Cilium and associated proteins [BR:mjv03037]  Motile cilia and associated proteins   Dynein arm    108392604 (DYNLT1) Cytoskeleton proteins [BR:mjv04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      108392604 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  108392604 NCBI-ProteinID:  XP_017508448 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MEDFQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSTFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactttcaggctgcagaggagactgcttttgttgttgatgaagtgagcaacatt gtgaaagaggcgatagaaagtgcaattgggggcaacgcctaccagcatagcaaagtgaat cagtggaccacaaatgtagtggaacagactttaagccaactcacgaaactgggaaaacca tttaaatacattgtgacctgtgtaatcatgcagaagaatggcgcgggcttacacacagcc agttcttgcttctgggacagctcgactgacgggagctgcaccgtgcggtgggagaacaag accatgtactgcattgtcagcaccttcggactgtccatctga

DBGET integrated database retrieval system