Manis javanica (Malayan pangolin): 108393043 Help Entry 108393043         CDS       T06054                                  Symbol FGF9 Name (RefSeq) fibroblast growth factor 9   KO K04358   fibroblast growth factor Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04010   MAPK signaling pathway mjv04014   Ras signaling pathway mjv04015   Rap1 signaling pathway mjv04020   Calcium signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04810   Regulation of actin cytoskeleton mjv05200   Pathways in cancer mjv05207   Chemical carcinogenesis - receptor activation mjv05218   Melanoma mjv05224   Breast cancer mjv05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108393043 (FGF9)    04014 Ras signaling pathway     108393043 (FGF9)    04015 Rap1 signaling pathway     108393043 (FGF9)    04020 Calcium signaling pathway     108393043 (FGF9)    04151 PI3K-Akt signaling pathway     108393043 (FGF9)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     108393043 (FGF9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108393043 (FGF9)    05207 Chemical carcinogenesis - receptor activation     108393043 (FGF9)   09162 Cancer: specific types    05226 Gastric cancer     108393043 (FGF9)    05218 Melanoma     108393043 (FGF9)    05224 Breast cancer     108393043 (FGF9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108393043 (FGF9)    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108393043 (FGF9) Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Growth factors (RTK binding)    108393043 (FGF9) Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Growth factors/receptors    108393043 (FGF9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  108393043 NCBI-ProteinID:  XP_017509126 LinkDB All DBs Position 1:complement(9677551..9713333) Genome browser AA seq 208 aa AA seqDB search MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGARTKR HQKFTHFLPRPVDPDKVPELYKDILSQS NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggttccgtttggg aatgtgcctgtgttgccggtggacagtccggttttgttaagtgaccacctgggtcagtcc gaagcaggggggcttcccaggggacccgcagtcacggacttggatcacttaaagggaatt ctcaggcggaggcagctttactgcaggactggatttcacttagaaatcttccccaatggc actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata gcagtgggtctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag aagggggagctgtatggatcagaaaagctaacccaagaatgcgtattcagagaacagttt gaagaaaactggtataatacatattcttcgaatctgtataaacacgtggacactggaagg cgatactatgtcgcgttaaataaagacgggaccccgagagaaggagcgaggactaaacgg caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaacta tataaggatattctaagccaaagttga

DBGET integrated database retrieval system