Manis javanica (Malayan pangolin): 108393279 Help Entry 108393279         CDS       T06054                                  Symbol FGF20 Name (RefSeq) fibroblast growth factor 20   KO K04358   fibroblast growth factor Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04010   MAPK signaling pathway mjv04014   Ras signaling pathway mjv04015   Rap1 signaling pathway mjv04020   Calcium signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04810   Regulation of actin cytoskeleton mjv05200   Pathways in cancer mjv05207   Chemical carcinogenesis - receptor activation mjv05218   Melanoma mjv05224   Breast cancer mjv05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108393279 (FGF20)    04014 Ras signaling pathway     108393279 (FGF20)    04015 Rap1 signaling pathway     108393279 (FGF20)    04020 Calcium signaling pathway     108393279 (FGF20)    04151 PI3K-Akt signaling pathway     108393279 (FGF20)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     108393279 (FGF20)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108393279 (FGF20)    05207 Chemical carcinogenesis - receptor activation     108393279 (FGF20)   09162 Cancer: specific types    05226 Gastric cancer     108393279 (FGF20)    05218 Melanoma     108393279 (FGF20)    05224 Breast cancer     108393279 (FGF20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108393279 (FGF20)    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108393279 (FGF20) Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Growth factors (RTK binding)    108393279 (FGF20) Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Growth factors/receptors    108393279 (FGF20) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  108393279 NCBI-ProteinID:  XP_017509471 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAAERGVRGGPGTAELAHL HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR SKRHQKFTHFLPRPVDPERVPELYKDILMQS NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggctcccttagccgaagtcgggggcttcctgggcggcctggagggcttgggccagcag gtgggctcgcacttcctgctgcctcctgccggggagcggccgcctctactgggcgagcgc cggggcgcggcggagcggggcgtccgcggcgggcctgggactgcggagctggcgcacctg cacggcatcctgcgccgtcggcagctctactgccgcaccggcttccacctgcagatcctg cccgacggcagcgtgcagggcacccggcaggaccacagcctcttcggtatcctggaattc atcagtgtggcagtgggactggtcagtattagaggtgtggacagtggtctttaccttgga atgaatgacaaaggagaactctatggatcggagaaactgacttctgaatgcatcttcagg gagcaatttgaagagaactggtataatacatactcatccaacatatataaacacggagac actggccgcaggtattttgtggcgcttaacaaagatggaaccccgagagatggtgccagg tccaaaagacatcagaaattcacacacttcctgcctagaccagtggatccagaaagagtt cctgaattgtacaaggacatactgatgcaaagttga

DBGET integrated database retrieval system