Manis javanica (Malayan pangolin): 108395351 Help Entry 108395351         CDS       T06054                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04015   Rap1 signaling pathway mjv04810   Regulation of actin cytoskeleton mjv05014   Amyotrophic lateral sclerosis mjv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     108395351 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     108395351 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108395351 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108395351 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mjv04131]     108395351 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mjv04812]     108395351 (PFN1)    04147 Exosome [BR:mjv04147]     108395351 (PFN1) Membrane trafficking [BR:mjv04131]  Others   Actin-binding proteins    Others     108395351 (PFN1) Cytoskeleton proteins [BR:mjv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      108395351 (PFN1) Exosome [BR:mjv04147]  Exosomal proteins   Proteins found in most exosomes    108395351 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  108395351 NCBI-ProteinID:  XP_017513032 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggttataaggactcgccctctgtctgggccgctgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaatgggctaacacttgggggccagaaatgctctgtgatccgggactcactgctgcag gatggggaatttactatggatctgcgtaccaagagcaccggcggagcccccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcttcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system